Protein Info for RR42_RS08895 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 311 to 339 (29 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 62% identity to reh:PHG263)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAB9 at UniProt or InterPro

Protein Sequence (428 amino acids)

>RR42_RS08895 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MRAAHLTYENAPRPSVVLGCLLPAPWLGATAGLLLAFGPSDGLPLRFSPTVLAVVHLLAL
GMLVPVMVGALFQMMPVVAGVRVRGSDALARLVALLGGATALGLAGGFLAGRPLGFRVAM
VLGAPFLGLVGLALLRAGARVVAVDATTRTLAGIGAALIATAATGAALAGVLGGQWQLAP
GPLLRLHVAWGLVGWIATLVTGVATTVVPMFWQTGRLPAALERFLPWGIWLLLLAYSGAV
IDAPQFSGAGAAPLLLLLGALAAYGLGGVLRARRRHDPCWRLWAAACVSAIGAVALSLAA
IALPVSIAIPWWIGIAVLVGCGVLPVTAMIGKIVPFLIWMHLRRRLPLPARIPAMQAMIS
PGQQRWQANLLLLAYVLLLALPLAPRWLALPGGVLFAAANVWLGLQLLRAVRCLHRTMAR
GGLPPRHA