Protein Info for RR42_RS07940 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 133 to 177 (45 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details PF12911: OppC_N" amino acids 20 to 69 (50 residues), 48.1 bits, see alignment 8.5e-17 PF00528: BPD_transp_1" amino acids 113 to 288 (176 residues), 82.5 bits, see alignment E=3.3e-27

Best Hits

Swiss-Prot: 41% identical to GSID_PECAS: Glutathione transport system permease protein GsiD (gsiD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 91% identity to reh:H16_A1472)

Predicted SEED Role

"ABC-type dipeptide/oligopeptide/nickel transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7K8 at UniProt or InterPro

Protein Sequence (295 amino acids)

>RR42_RS07940 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MEMTLKKPALVPVVQRSPGYWATVGKRLLRNKVAMLAALIVLALVLMAIFAPVLMPADPY
AASIMKRLKPIGTEHYLLGTDELGRDLLSRLMLGARLSLFMGITPVLIAFVIGSALGIVA
GYAGGWTNTVIMRLVDILYAFPSVLLAIALSGTLGAGVGNALLSLTIVFVPQIVRVAESV
TTQVRNREFVDAARASGASSLTIVRAHVLNNVLGPIFVYATSLISVSMILASGLSFLGLG
VKPPEPEWGLMLNTLRTAIYTQPLVAALPGAMIFLTSISFNLLADGIRSAMEIKD