Protein Info for RR42_RS07930 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00005: ABC_tran" amino acids 45 to 203 (159 residues), 111.4 bits, see alignment E=1.1e-35 PF13304: AAA_21" amino acids 146 to 234 (89 residues), 28.4 bits, see alignment E=3.2e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 252 to 337 (86 residues), 78.9 bits, see alignment E=1.2e-26 PF08352: oligo_HPY" amino acids 254 to 318 (65 residues), 66.1 bits, see alignment E=5.7e-22

Best Hits

Swiss-Prot: 42% identical to DPPD_HAEIN: Dipeptide transport ATP-binding protein DppD (dppD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 83% identity to reh:H16_A1470)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7Q6 at UniProt or InterPro

Protein Sequence (350 amino acids)

>RR42_RS07930 peptide ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MTAPVSVPVTAPNHSTHPQAAAPMVSVRDLRVTFSGGGKTIRAVSGVSLEVAPGETLALI
GESGSGKSVTLRALMRLHPPRRTRMEGEIRIDGTDVTALDGRGLARLRGGKVAMVFQEPL
LALDPVYTIGQQIIECIRTHARVSAAEARQRALRALESVRIPSPERRLAAYPHEMSGGMR
QRAMIALALSANPKVLLADEPTTALDATVQIQVLILLRELQRELGLSIVFVTHDIGAAVE
IADRVAVMYGGRIVEEGPIRTILRAARHPYTMALLQSRQHGMDRGQRLQTIAGSPPDLSA
LPPGCSFAPRCPHARAQCLEAVPRATALGGGHSVSCVLASEPIARAEALA