Protein Info for RR42_RS07880 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details PF16524: RisS_PPD" amino acids 48 to 154 (107 residues), 133.8 bits, see alignment E=6.1e-43 PF00672: HAMP" amino acids 180 to 232 (53 residues), 37.5 bits, see alignment 4.9e-13 PF00512: HisKA" amino acids 240 to 291 (52 residues), 38.8 bits, see alignment 1.6e-13 PF02518: HATPase_c" amino acids 335 to 442 (108 residues), 66.5 bits, see alignment E=5.6e-22

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 92% identity to reh:H16_A1462)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y1L5 at UniProt or InterPro

Protein Sequence (449 amino acids)

>RR42_RS07880 histidine kinase (Cupriavidus basilensis FW507-4G11)
MATVISRTATRLFGSLFWRTFMLIALLLAISLGIWFQSYRLFERAPRAQQIAMQVVSVVK
LTRAALLYSDPARRRFLLLDLVQNEGIKVYPREKDDDFSVPTTNPFLTQLVQQEIRSRLG
EETVIATTVNDIPGVWVSFEIEGDDYWVAISPERFERVPGIQWLWWSIAALLLSIIGAAF
ITSLVNHPLKRLANAARAIGGGGDPPTLPEHGASEVAQANHSFNQMVRDLRQLDDDRVVM
LAGISHDLRTPLTRLRLETEMSPVDNTTREAMIADIEQMDAIIGQFLNYARPALETVEPV
DLSALVQDAVGVYGAHDDVRVHVRAGDPVMAVANRMEVQRILDNLVENARRYAKDEDNGV
AVVEISTRIEDKEAVLTVADHGSGVPEAQLPLLTRPFYRLDGARSEAKGAGLGMSIVNRI
LQRNGGRLMLANRPPPATGLVVSAFFRRA