Protein Info for RR42_RS07815 in Cupriavidus basilensis FW507-4G11

Annotation: glutamine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 165 (149 residues), 135 bits, E=2.9e-43

Best Hits

Swiss-Prot: 59% identical to ARTM_BACSU: Arginine transport ATP-binding protein ArtM (artM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 73% identity to pna:Pnap_1030)

MetaCyc: 59% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

See A0A0C4Y9M7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>RR42_RS07815 glutamine ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MIKMEQLSKSYGAHRVLSNIDAEIRQGEVVCLIGPSGSGKSTMLRCINGLEQYQGGSITI
DGERVNAASPGIRQIRQRVSMVFQRFNLFPHRTALENVMEGPVHVKKESVAEAKERAAEI
LASVGLAEKMAHYPTQLSGGQQQRVAIARALAMRPDAILFDEPTSALDPELVGEVLGVMR
KLAEKGMTMVIVTHEMKFAREVSNRVLFLDGGRIAEQGPSAQVLTQPSNERMQDFLRRVT
HAG