Protein Info for RR42_RS07730 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 23 (1 residues), see Phobius details amino acids 45 to 69 (25 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 66% identity to rpi:Rpic_4371)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9L3 at UniProt or InterPro

Protein Sequence (206 amino acids)

>RR42_RS07730 membrane protein (Cupriavidus basilensis FW507-4G11)
MSDIAGLLVLAVVVFGLNLMPAFAPPTWMVMSWIGFSLPEANPALLALAAACAATTGRLV
LAQMAFTLVRQRWMREDDRRNIDVVGQWLGRRKSMTMGFMLAYAFSPFPSNYLFIAYGLT
GMRLWMIGLPFFAGRLISYFMWTHLAQVGSRYLDTDVDGAYFGLYFVLSQLLLLAAVYLF
TRVDWVCLLHERRLRWRRSRRLSSPP