Protein Info for RR42_RS07615 in Cupriavidus basilensis FW507-4G11

Annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01829: acetoacetyl-CoA reductase" amino acids 4 to 245 (242 residues), 413.1 bits, see alignment E=2e-128 PF00106: adh_short" amino acids 5 to 197 (193 residues), 224.3 bits, see alignment E=2.1e-70 PF01370: Epimerase" amino acids 7 to 143 (137 residues), 30.1 bits, see alignment E=6.6e-11 PF08659: KR" amino acids 8 to 179 (172 residues), 76.8 bits, see alignment E=4e-25 PF13561: adh_short_C2" amino acids 14 to 244 (231 residues), 197.5 bits, see alignment E=5.3e-62

Best Hits

Swiss-Prot: 96% identical to PHAB_CUPNH: Acetoacetyl-CoA reductase (phaB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 95% identity to reu:Reut_A1349)

MetaCyc: 96% identical to hydroxyvaleryl-CoA reductase / acetoacetyl-CoA reductase (Cupriavidus necator)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]; 1.1.1.36 [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9I9 at UniProt or InterPro

Protein Sequence (246 amino acids)

>RR42_RS07615 3-ketoacyl-ACP reductase (Cupriavidus basilensis FW507-4G11)
MTQRIAYVTGGMGGIGTAICQRLAKDGYKVVAGCGPNSPRREKWLEQQKALGFDFVASEG
NVADWDSTKAAFDKVKAEVGEVDILINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVT
KQVIDGMADRGFGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNT
VSPGYIATDMVKSIRQDVLDKIVGTIPVKRLGAPEEIASICAWLASEESGFSTGADFSLN
GGLHMG