Protein Info for RR42_RS07555 in Cupriavidus basilensis FW507-4G11

Annotation: potassium transporter Kup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 51 to 77 (27 residues), see Phobius details amino acids 86 to 101 (16 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 295 to 325 (31 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details PF02705: K_trans" amino acids 21 to 553 (533 residues), 754.8 bits, see alignment E=2.5e-231

Best Hits

Swiss-Prot: 88% identical to KUP_CUPMC: Probable potassium transport system protein kup (kup) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 88% identity to rme:Rmet_1231)

MetaCyc: 53% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDT5 at UniProt or InterPro

Protein Sequence (632 amino acids)

>RR42_RS07555 potassium transporter Kup (Cupriavidus basilensis FW507-4G11)
MTQPATSHYFVESPSKRALVIGAIGVVFGDIGTSPLYALKECFSKEHGIPFSDAAVMGII
SMLFWAMIIVVSLKYVMFVMRADNDGEGGILALMALALRTAAPRSRMAKLLMMFGIFGAC
MFYGDAVITPAISVLSAVEGLEIAAPGLTHFVIPITLVILVALFMIQRSGTAAVGKLFGP
IMMVWFAALGALGVYHMMHAPSILMAVNPYYAVTFLMEHSLQAFVVLGSVFLVLTGAEAL
YADMGHFGIRPIRTGWFAVVMPCLMLNYFGQGAMLLQNPEAVSNPFYLMVPQPLLIPMVL
LATCATVIASQAVISGAFSLTSQAIQLGFVPRMRIRYTSDAEIGQIYLPVINWLLLVLVV
IVVVAFKKSDNLAAAYGIAVTTTMVITTFLAAVVMRNVWKWNPILVTLIGLTFLLVDLAF
FSANLLKIAEGGWFPLLMGGTAFFLLMTWHSGRKLLRARSLEDGIPLEPFIGGLLAHPPH
RVEGTAVFLTGNTESVPVSLLHNLKHNRVLHERVVFLSFVTRDVPYVDDDHRLTCKDLGG
GVFILKSEYGFKETPDVQRVLDLAQRKLNMQFELMETSFFIARESVIPSKLPGMSMWRES
LFAWMHQNGAKPSDFFQIPANRVVELGTKVEI