Protein Info for RR42_RS07540 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 86 (34 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 318 (269 residues), 151 bits, see alignment E=1.8e-48

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 85% identity to reh:H16_A1416)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7J1 at UniProt or InterPro

Protein Sequence (341 amino acids)

>RR42_RS07540 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MPSDSNALEGPVRARSQPMPWLGGLGWLAAFAVLAVLPLLLNADGQRFYIELVSKVMIMA
IFALSLQLLIGYTGLVSLGHAAYFAMAAYATAMMAPQAGPGNGWLMLLGALGAAALLALV
VGALVLRTRGIYFIMVTLAFAQMVYFVFHDTKIAGGSDGTYIYFRPEFGLLGAHPFDVND
VTHFYWLVLGALVLTVAGLAVVLRSRFGHALVGIKHNEQRMRAAGYATYRYQLGAFVVAG
TFAGLAGYLYAIQYGFVNPEIASWHQSGNAMLMVILGGAGSLAGAVLGAFSFVLLAEWFS
TLTKHWQLLMGGFVILAVALLPHGLISLARGAARRRQGGSR