Protein Info for RR42_RS07535 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 44 to 89 (46 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 223 to 252 (30 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 277 (267 residues), 134.4 bits, see alignment E=2.2e-43

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 93% identity to reu:Reut_A1330)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y1G7 at UniProt or InterPro

Protein Sequence (288 amino acids)

>RR42_RS07535 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MDIVSFFIQCLNSIQYGLLLFLVASGLTLIFGIMGVINLAHGSFYMLGAYLAFTLAGLTG
SLLIAVPLGIVLAVAFGYVLEWVFFSYLYEREHLQQVLMTYGLILVFEELRSILVDDDVH
GVTVPAMLDWALPIGNDMTYPVYRLFISAICLLVAAAMYLVIRRTRLGMMIRAGATNREM
VQSLGINVTVLYRFVFALGVALAVLAGMIAAPVSSVYPGMGSQVLIVCFVVVVIGGIGSV
KGAMVASLLLGFVDTFGKVFWQEASGVLVYLLMALILLWKPQGLFKAG