Protein Info for RR42_RS07430 in Cupriavidus basilensis FW507-4G11

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 3 to 83 (81 residues), 54 bits, E=7.7e-19
  • amino acids 132 to 216 (85 residues), 56.3 bits, E=1.4e-19

Best Hits

Swiss-Prot: 46% identical to LUTA2_BACCQ: Lactate utilization protein A 2 (lutA2) from Bacillus cereus (strain Q1)

KEGG orthology group: None (inferred from 89% identity to reu:Reut_A1310)

MetaCyc: 43% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• L-histidine degradation V (1/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.27

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See A0A0C4Y1F7 at UniProt or InterPro

Protein Sequence (241 amino acids)

>RR42_RS07430 Fe-S oxidoreductase (Cupriavidus basilensis FW507-4G11)
MRVGLFATCLVDLMRPEIGFSVLKLLEKAGFEVMVPEAQTCCGQPAYNSGERTASRGLAE
KFLREFEMFDYVVIPSGSCGGMVLHHYADLLGDDPELNGRYEGLRSRVFELTDFLVNVAK
LGEFDSKFTGRITYHDSCSGLRELGVKSQPRALLAQLPGVQLSEMKDCEACCGFGGTFSV
KYGNISTAIVDEKCANIKASGADAVVLGDLGCMLNIEGRLRRTGDTRTQVLHIAQVLAGD
A