Protein Info for RR42_RS07360 in Cupriavidus basilensis FW507-4G11

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 862 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 74 to 98 (25 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 360 to 483 (124 residues), 94.1 bits, see alignment E=3.5e-31 amino acids 487 to 612 (126 residues), 24.4 bits, see alignment E=1.3e-09 PF00989: PAS" amino acids 361 to 473 (113 residues), 68.4 bits, see alignment E=1.6e-22 PF13188: PAS_8" amino acids 361 to 412 (52 residues), 31.4 bits, see alignment 4.1e-11 PF08448: PAS_4" amino acids 373 to 478 (106 residues), 48.6 bits, see alignment E=2.7e-16 PF13426: PAS_9" amino acids 376 to 475 (100 residues), 52.6 bits, see alignment E=1.5e-17 PF08447: PAS_3" amino acids 383 to 466 (84 residues), 30.5 bits, see alignment E=1.1e-10 PF02518: HATPase_c" amino acids 741 to 856 (116 residues), 76.9 bits, see alignment E=4.8e-25

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 92% identity to cti:RALTA_A1292)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y1F0 at UniProt or InterPro

Protein Sequence (862 amino acids)

>RR42_RS07360 ATPase (Cupriavidus basilensis FW507-4G11)
MPSLKDFFSHLRAAVVPPSASGSAKASGSDPTLTAPPNPLTSLDTLGHVDEPAAVNGPPR
GLWWLRWRNLVATSWFMFIPLVAIVLFTVAMGVILWSLHETERQQQRDALYRDAAWAQQR
VRLSLLSNQDQLASLARDIAAAQLDQGAYRTAAQEILRENPEIVFVNWLDATRRGRWSLP
STSEFASRLRETQDQPLEPEVLDTFDAARETQRVVYSRPLVNDRGDSFMLMEVPIVRDNE
FLGTLGALYSVNGILTHLLPPELTERYRFSLIDKNNQIRASTSLRPVPGNALSYEVLLDP
PGHSLSLRADAYPPASNLPNNMLLWLVVGLSCFLLWSLWSMWRHTSRRSEAQRALLAETS
FRRAMENSMLIGLRALDLNGRITYVNPAFCRMTGWQDSDLVGRVPPFPYWPPNDHQEMQK
QIDLTLQGKSPASGYEMRAMRRDGSSFYARMYVSPLVDSRGRHTGWMASMTDITEPKRAR
EELAAAHDRFTTVLESLDAAVSVLATDKPELLFANRYYRQLFGWEAEGHLKLAGGEVDKE
QVSSDATDFVDAYAGLPASELMPYSSDAREVFVPDMQKWFEVRRRYIQWVDGHLAQMQIA
TDITVRKAAEEMARQHEERLQFTSRLTTMGEMASSLAHELNQPLAAINNYCMGAVARLRS
GRSTAEDLIPILEKTSAQAVRAGTIISRIRGFVKRSQPQRREAALHDIVADAVGLADLEA
TRRRVTILTRLPPPPVVLFVDPVLIEQVLVNLLKNAVEAMAGLPALRATGVVRLHARIEP
GEIGPNMRIDVIDQGPGVDEATKERLFEPFFSTKSDGMGMGLNICRSIIESHQGRLWVEN
NADGIGCTFKIMLPLQPALIDQ