Protein Info for RR42_RS06490 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details PF01306: LacY_symp" amino acids 20 to 192 (173 residues), 31.4 bits, see alignment E=1.9e-11 PF12832: MFS_1_like" amino acids 20 to 373 (354 residues), 274.2 bits, see alignment E=3.7e-85 PF07690: MFS_1" amino acids 25 to 291 (267 residues), 71.6 bits, see alignment E=1.2e-23 PF03825: Nuc_H_symport" amino acids 38 to 361 (324 residues), 56.4 bits, see alignment E=5.6e-19

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 80% identity to reh:H16_A1318)

Predicted SEED Role

"Nucleoside:H+ symporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6U9 at UniProt or InterPro

Protein Sequence (408 amino acids)

>RR42_RS06490 MFS transporter (Cupriavidus basilensis FW507-4G11)
MAQAEQRARAAGAGRVSETRFGLFYLGYYGYVGVISPYVSLFFAGRGFSPVQIGVLMACF
QVSRIVGPYFWGWLSDVMHTRVRLLRLAAVTSLLAFLMVPGVTSYGAMMAMMIGLNLITS
AMSPLGDALTISTLRRYGAFDYRYGRIRMFGSAGFIVAVLLGGALFERYGMEVFPWLAST
MLALFLVVVFGMHDAPDDGPRVKPPPALPLLRRPDVSWFFGSAFLMMFAHAALYVFYSLY
LEQLGYSKLAIGVMWTIGVVAEIVFFFFQGRLFASVPLRTILAGTFVLAAIRFGLTGYFA
RLSWLMALVQVLHAATFGAHHSASLKRLQRWFAGPLQGRGQALYTGLSYGLGGTCGGLAM
GWTWKALGPAHTFGLAALAAAGGALCAFMTFRTEAASDAKAQAATAGR