Protein Info for RR42_RS06460 in Cupriavidus basilensis FW507-4G11

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF12146: Hydrolase_4" amino acids 27 to 241 (215 residues), 76.5 bits, see alignment E=8.2e-25 PF00561: Abhydrolase_1" amino acids 27 to 256 (230 residues), 76.8 bits, see alignment E=8.4e-25 PF12697: Abhydrolase_6" amino acids 27 to 262 (236 residues), 87.2 bits, see alignment E=1.1e-27 PF02129: Peptidase_S15" amino acids 37 to 239 (203 residues), 23.1 bits, see alignment E=2.2e-08 PF06821: Ser_hydrolase" amino acids 48 to 130 (83 residues), 27 bits, see alignment E=1.5e-09 PF00975: Thioesterase" amino acids 50 to 114 (65 residues), 42.3 bits, see alignment E=4e-14 PF00756: Esterase" amino acids 84 to 189 (106 residues), 22.2 bits, see alignment E=4.2e-08

Best Hits

KEGG orthology group: None (inferred from 86% identity to reh:H16_A1312)

Predicted SEED Role

"PROBABLE HYDROLASE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y960 at UniProt or InterPro

Protein Sequence (274 amino acids)

>RR42_RS06460 alpha/beta hydrolase (Cupriavidus basilensis FW507-4G11)
MELTIAGRKAYAYTGGKPFDPALPCAVFVHGAQNDHSVWALQTRWFANHGFSVLAVDLPG
HNRSEGMPLDTVEAMADWVIELVRAAGVSTPALVFGHSMGSLIALETAARHPDAVRGIAL
LATAYPMKVADALLDASLNRVDQAIAMVNAWSHSSLANKPSSPGPGSWMQGGSQRLMERV
AQRNPEGHVFHNDFSACNAYANGDAAVAAVRCPALFISGSKDMMTSPKAAQALAARMASA
STVTVPCGHALMGEKPDEVLDALAAFARKVVAAG