Protein Info for RR42_RS06345 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF13432: TPR_16" amino acids 73 to 129 (57 residues), 36.6 bits, see alignment E=2.4e-12 PF14559: TPR_19" amino acids 74 to 128 (55 residues), 33.9 bits, see alignment E=1.5e-11 amino acids 107 to 163 (57 residues), 26.8 bits, see alignment E=2.4e-09 PF13431: TPR_17" amino acids 86 to 117 (32 residues), 22.7 bits, see alignment 3.8e-08 PF13181: TPR_8" amino acids 134 to 163 (30 residues), 12.2 bits, see alignment 7.9e-05

Best Hits

KEGG orthology group: None (inferred from 66% identity to cti:RALTA_A1198)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDC7 at UniProt or InterPro

Protein Sequence (232 amino acids)

>RR42_RS06345 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MSLFLPTLATVSSQPARQRIAAASFALAAILAGLLAVAGPARAQNGPLSLAVPATTPGGV
RSADPGMADAEKAAAHQQYGEAIDRFDRVLATNPRNAQARFERAWALAQAGREDEAIAAL
QSMAQDFPELPEPHNNLALLYAKRGDLKRAEAELLIAIDVKPDFAVGYANLGDVYRRLAE
NAYRNALRRNPKDAGAAASLKQLQPVEAIQPPADGARGPGAAASKPATAPKP