Protein Info for RR42_RS06220 in Cupriavidus basilensis FW507-4G11

Annotation: ferredoxin-NADP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF07992: Pyr_redox_2" amino acids 24 to 320 (297 residues), 80.3 bits, see alignment E=4.5e-26 PF13450: NAD_binding_8" amino acids 27 to 63 (37 residues), 22.6 bits, see alignment 2.7e-08 PF13738: Pyr_redox_3" amino acids 129 to 314 (186 residues), 41.4 bits, see alignment E=2.8e-14 PF00070: Pyr_redox" amino acids 183 to 224 (42 residues), 29.9 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 85% identical to FENR1_CUPNH: Ferredoxin--NADP reductase 1 (H16_A1199) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 85% identity to reh:H16_A1199)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6Q7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>RR42_RS06220 ferredoxin-NADP reductase (Cupriavidus basilensis FW507-4G11)
MQTPACATPDSRTPTVPADVIRTDVLIVGAGPVGLFAAFQAGVLGLKCELIDVLDRAGGQ
CTELYPEKPIYDIPAVPGCLAQDLVDRLLEQCAPFAFPMHFNERANGLAEVPPEPQATAG
HEHPHRLLVTTDTGKRFDVAAVLICAGAGAFAPQRVALPEAAALEDRHLHYAVRDTARFA
GKRVVVAGGGDSALDWALALRKTAARVTLLHRREGFRAADGAVAEMRAAVAAGEMDFVVG
MLGALKTEGDALAGVDIRTREDTISLPADELVALYGLVSEPGPIAQWDLDMRAGRIVVDT
TTYETSRRGIFAAGDIAFYPNKQKLILSGFHEAALALRRAYHYAFPEKALVHVHTSNNAT
LKEKLTHA