Protein Info for RR42_RS06015 in Cupriavidus basilensis FW507-4G11

Annotation: recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 transmembrane" amino acids 367 to 389 (23 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 460 to 480 (21 residues), see Phobius details amino acids 508 to 528 (21 residues), see Phobius details amino acids 568 to 590 (23 residues), see Phobius details amino acids 599 to 618 (20 residues), see Phobius details amino acids 623 to 648 (26 residues), see Phobius details PF10136: SpecificRecomb" amino acids 34 to 681 (648 residues), 770.7 bits, see alignment E=6e-236

Best Hits

KEGG orthology group: None (inferred from 80% identity to reh:H16_A1156)

Predicted SEED Role

"Site-specific recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8Z9 at UniProt or InterPro

Protein Sequence (696 amino acids)

>RR42_RS06015 recombinase (Cupriavidus basilensis FW507-4G11)
MFRSLFRKWRESRNASLQLDAILAAADPEAPLADRNGWLIELGYWIRRDGLPGAEGVAAD
KSRREHVRLRYLLQVLGRNPEVAGRFARMVRAIVRDNDPVTLLCDTGVASHPGFWSEVLN
RLQARFLPPPPNRSDMAGLFALLFIDDNDADWVEALDGDLLERLAAVLRTDDPQAPGDAA
ELPEWDRFDRTLTTSIQVLVSQVRATGLSQAIRSRLKGKVQDTPFFRLDSAVQALCDEEE
AARGGEAFAHRLNYFRALLDGCHQAAQRVYDDLEENGVSVEVVFQIERMKVRLARIELLL
ATWVEPQRRGRHAHLIAALIRSTQARRSIGHLAGTSFSQLARKVVERSAETGEHYITRDR
REYRELMRAAAGGGLITVGTVYLKFLIYGLHLDKFIEGLLASLNYAGSFLVIHFAHFTLA
TKQPAMTGPALAHRLDAVGRPEGREIFVEDTIAMIRSNAAAIFGNLAVVFPVAMGIQWLA
NRILGANLITPAKAIATIESFSILGPTPIYAIFTGVLLWLSSLVAGWADNWFALHKVHDV
MAYNRRLRYVLGARGATRMADFWKRNMSGIAANVSLGLLLGLGPEILSFFGPHMEVRHVT
LSTGSVGAAIGVLGIAVLKMPSFWLAVAGIALMGLLNVAVSFALAFNMALRSRSLRPVDR
RALSSAVRRRILKHPWSLIVPPRAPVGGASAEQGQV