Protein Info for RR42_RS05985 in Cupriavidus basilensis FW507-4G11

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01849: polyhydroxyalkanoate depolymerase, intracellular" amino acids 2 to 411 (410 residues), 595.3 bits, see alignment E=2.6e-183 PF06850: PHB_depo_C" amino acids 211 to 411 (201 residues), 328.9 bits, see alignment E=5.4e-103

Best Hits

KEGG orthology group: K05973, poly(3-hydroxybutyrate) depolymerase [EC: 3.1.1.75] (inferred from 91% identity to reh:H16_A1150)

Predicted SEED Role

"Intracellular PHB depolymerase (EC 3.1.1.-)" in subsystem Polyhydroxybutyrate metabolism (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.1.75

Use Curated BLAST to search for 3.1.1.- or 3.1.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y0Z7 at UniProt or InterPro

Protein Sequence (413 amino acids)

>RR42_RS05985 esterase (Cupriavidus basilensis FW507-4G11)
MLYQLHEFQRSMLHPLTAWAQATAKTFTNPLSPMSLVPGATRLAAGYELLYRLGKEYEKP
EFDIKSVRSNGRNIPIVEQTIIEKPFCKLVRFKRYADDPETIKLLKDEPVVLVCAPLSGH
HATLLRDTVKTLLQDHKVYVTDWIDARMVPIEDGRFRLADYIHYIQDFIRHIGAENLHVI
SVCQPTVPVLAAISLLASAGEKTPKTMTMMGGPIDARRSPTAVNSLATNKSFEWFENNVI
YTVPANYPGHGRKVYPGFLQHAGFVAMNPDRHLSSHYDYYLNLVEGDADDAEAHVRFYDE
YNAVLDMDAEYYLDTIREVFQEFRLANGTWEIDGQPVRPQDIKGTALLTIEGELDDISGA
GQTAAAHELCAGIPKARKQHITAAKCGHYGIFSGRRWRQEIYPELRDFVLKHR