Protein Info for RR42_RS05625 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hydroxyacetophenone monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF00743: FMO-like" amino acids 10 to 344 (335 residues), 64.6 bits, see alignment E=2.8e-21 PF07992: Pyr_redox_2" amino acids 11 to 191 (181 residues), 37.1 bits, see alignment E=1.1e-12 PF00890: FAD_binding_2" amino acids 12 to 48 (37 residues), 21.1 bits, see alignment 7.4e-08 PF13738: Pyr_redox_3" amino acids 13 to 210 (198 residues), 63.8 bits, see alignment E=7.3e-21 PF13450: NAD_binding_8" amino acids 14 to 77 (64 residues), 39 bits, see alignment E=3.6e-13 PF13434: Lys_Orn_oxgnase" amino acids 80 to 343 (264 residues), 39.5 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 49% identity to mpt:Mpe_A0895)

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.22

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6L7 at UniProt or InterPro

Protein Sequence (495 amino acids)

>RR42_RS05625 4-hydroxyacetophenone monooxygenase (Cupriavidus basilensis FW507-4G11)
MKASTTSGADQIVIIGAGVAGMCMGIKLKQAGIDDFVVLEKAATVGGTWRDNTYPGCGCD
IPSHLYSFSFAPKPDWSSAYSPQPEIHRYLQHCAERFGLLGHIRFGTEVTEARYDQAACL
WRVSTSNGDTIAARILVSGTGQLNRPLTPDIAGLDRFAGTAFHSARWRHDADLRDKQVAV
IGNGASALQFIPRIAPEAGKLTVFQRSANWVLPRNGEAYTSGQQARFERHPWTARLHRWH
LYLQRELRFGRMQRDSGRNRELETLARRYLAHMIPDPVLRTRLTPDYPIGCKRILISDDF
YQALKRPNVHVETARIDHVEADAVVTADGARHRADAIVFATGFDARSFLAPIRITGRHGR
TLADQWHEDPEAYLGMTAPGFPNLFVLYGPNTNLGHNSIIFMLECQARYVLQCIRACRSA
RFASMEVRPEVVTRFNQALQAAIGQTAWAGSCSSWYKSASGRVTNNWSSHATAYWWKTRK
PHWGHFVLRHAGERS