Protein Info for RR42_RS05480 in Cupriavidus basilensis FW507-4G11

Annotation: 30S ribosomal protein S15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 TIGR00952: ribosomal protein uS15" amino acids 8 to 90 (83 residues), 133.1 bits, see alignment E=1.8e-43 PF00312: Ribosomal_S15" amino acids 9 to 89 (81 residues), 129.8 bits, see alignment E=1.7e-42

Best Hits

Swiss-Prot: 91% identical to RS15_CUPTR: 30S ribosomal protein S15 (rpsO) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 91% identity to cti:RALTA_A1028)

MetaCyc: 66% identical to 30S ribosomal subunit protein S15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S15p (S13e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8K9 at UniProt or InterPro

Protein Sequence (90 amino acids)

>RR42_RS05480 30S ribosomal protein S15 (Cupriavidus basilensis FW507-4G11)
MAEAQISSKTEVIKQFARAANDTGSPEVQVALLTTRINELTPHFKANMKDHHSRRGLLRM
VSRRRRLLDYLKANDADRYRSLIEKLGLRK