Protein Info for RR42_RS05350 in Cupriavidus basilensis FW507-4G11

Annotation: tungsten ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12849: PBP_like_2" amino acids 29 to 251 (223 residues), 152.7 bits, see alignment E=2.6e-48 PF13531: SBP_bac_11" amino acids 42 to 260 (219 residues), 54 bits, see alignment E=3.1e-18

Best Hits

Swiss-Prot: 51% identical to TUPA_PEPAC: Tungstate-binding protein TupA (tupA) from Peptoclostridium acidaminophilum

KEGG orthology group: K05772, putative tungstate transport system substrate-binding protein (inferred from 86% identity to reh:H16_A1019)

Predicted SEED Role

"ABC-type tungstate transport system, periplasmic binding protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6E7 at UniProt or InterPro

Protein Sequence (275 amino acids)

>RR42_RS05350 tungsten ABC transporter substrate-binding protein (Cupriavidus basilensis FW507-4G11)
MSNRAACAIGLVCLVGMAGATIATSAFAGELKLATTTSTENSGLLKFLLPRFEQKSGVTV
KVIAVGSGKAMKMGEMGDVDVLLVHARKMEDEFVAAGYGVNRRDVMYNDFIVVGPASDPA
RLKGGKDVLAGFRKIAAGSTKFISRGDNSGTDVMEKDYWKQAGIEPKGQPWYVNAGLGMG
EVLTMAAQMPGYTLSDRATYGAYRAKTGLAILLEGDPRMFNPYGVIAVNPAKHPDANYVD
AMKLVEWITSRDGQDTIAAYKVEGEQLFFPSYRGK