Protein Info for RR42_RS05340 in Cupriavidus basilensis FW507-4G11

Annotation: FAD-binding molybdopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 6 to 478 (473 residues), 708.9 bits, E=1.4e-217
• PF00111: Fer2
  • amino acids 12 to 58 (47 residues), 23.6 bits, 8e-09
• PF01799: Fer2_2
  • amino acids 86 to 165 (80 residues), 100.2 bits, E=1.1e-32
• PF00941: FAD_binding_5
  • amino acids 207 to 370 (164 residues), 150.3 bits, E=9.3e-48
• PF03450: CO_deh_flav_C
  • amino acids 377 to 477 (101 residues), 123.4 bits, E=8.1e-40

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 83% identity to reu:Reut_A2425)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See A0A0C4YCU3 at UniProt or InterPro

Protein Sequence (504 amino acids)

>RR42_RS05340 FAD-binding molybdopterin dehydrogenase (Cupriavidus basilensis FW507-4G11)
METQTIRFYHRGKVTEVANAPVTRTVLQYLREDARCTGTKEGCAEGDCGACTVVLGELGE
NGQVEFKAVNACIQFLPTLDGRALITVEDLRQADGALHPVQQAMVECHGSQCGFCTPGFV
MSLWALYQQKSEDAGTGRAPAREAICDALTGNLCRCTGYRPIIEAGQRMMALPAPQASKL
DPRQIADTLRALRRDDTFHYSAAGQHFYAPRTASAFAAIKAAEPGVRILAGSTDVGLWVT
KQFRELGNLLYVGQVADLNGIREIDGALEIGAAVSLERAYAALNGVHPELEELWKRFASL
PIRNAGTLGGNIANGSPIGDSMPALIALGTEVVLQRGDVRRTLALEDLYLAYQKTAMAEG
EFVAALRVPLAGPEHFRTYKLSKRFDEDISAVCAAFALTLENGVIRDARVAFGGMAATPK
RGALTQAALIGQPWTEATARAAMSALAQDFTPLSDMRATAAYRSRGAANLLYRFWLETRA
DALPAAAVNVRAIGAGAATTTATA