Protein Info for RR42_RS05315 in Cupriavidus basilensis FW507-4G11

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 102 to 118 (17 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details PF00487: FA_desaturase" amino acids 62 to 322 (261 residues), 104.1 bits, see alignment E=5.5e-34

Best Hits

KEGG orthology group: K10255, omega-6 fatty acid desaturase (delta-12 desaturase) [EC: 1.14.19.-] (inferred from 86% identity to cti:RALTA_A0996)

Predicted SEED Role

"FIG00977867: hypothetical protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCT7 at UniProt or InterPro

Protein Sequence (366 amino acids)

>RR42_RS05315 fatty acid desaturase (Cupriavidus basilensis FW507-4G11)
MIATQQASFPEPISPDAPLPSRKIIRGWLIPLGARSTPRALALFALDTALFLAALAGVVL
FSHWLAKLAASVATGLIIARLFIIGHDACHQSLTPRRGLNKWLGRLTFLPSLTPYSLWEV
GHNVVHHGYSNLKGFDFVWQPYSLEEFQALPRWRRALERVYRTGFGAGLYYLVEIWWFKM
FFPSRRQMPTRRAVFMWDCTLVALFGVAWIGALAWLAIATGQSVALLVGLGFVLPFLVWN
FTVGFVLYVHHTHTSVAWYDTKAMWARAQPFVSTTVHLRFRYGIGAALHHIMEHTAHHVD
MSVPLYRLKRAQALLEHALPGRIIIQNFTWRWYFDTARRCKLYDFKALCWTDFRGRQTSA
NAPVPA