Protein Info for RR42_RS05250 in Cupriavidus basilensis FW507-4G11

Annotation: OHCU decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF09349: OHCU_decarbox" amino acids 11 to 167 (157 residues), 173.3 bits, see alignment E=2.7e-55 TIGR03164: OHCU decarboxylase" amino acids 15 to 169 (155 residues), 202.1 bits, see alignment E=2.7e-64

Best Hits

Swiss-Prot: 40% identical to URAD_HALVD: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (HVO_B0301) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: None (inferred from 77% identity to reu:Reut_A2438)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6D0 at UniProt or InterPro

Protein Sequence (172 amino acids)

>RR42_RS05250 OHCU decarboxylase (Cupriavidus basilensis FW507-4G11)
MSQTYTLDQLNALPAADFIQALGGIYEHSAWVAQAAATQRPFAHAAALADAMRAIVDGAG
DAAQIKLVRAHPELAGKAAVRGELTAESTREQSGAGLDQCSAAEFEQLQSLNRQYNEKFG
FPFILAVRGYDRAGIIGEFARRVSNEPAAELQTCINQIHRIAQFRLNDLVSG