Protein Info for RR42_RS05085 in Cupriavidus basilensis FW507-4G11

Annotation: 2-aminomuconate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF01042: Ribonuc_L-PSP" amino acids 13 to 135 (123 residues), 95.2 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 68% identical to AMND_PSESP: 2-aminomuconate deaminase (amnD) from Pseudomonas sp.

KEGG orthology group: K15067, 2-aminomuconate deaminase [EC: 3.5.99.5] (inferred from 80% identity to put:PT7_3612)

MetaCyc: 75% identical to 2-aminomuconate deaminase (Pseudomonas fluorescens KU-7)
2-aminomuconate deaminase. [EC: 3.5.99.5]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y698 at UniProt or InterPro

Protein Sequence (140 amino acids)

>RR42_RS05085 2-aminomuconate deaminase (Cupriavidus basilensis FW507-4G11)
MTTLSKVLTGKATPRGRFPHVKRAGDFLFVSGTSSRRADNSFAGASADAMGVTALDIHEQ
TRAVIGNIREILQSVGCDLSDLVEITTFLVNMNDFGGYNEVYGEYFDYDGPTRTTVAVHQ
LPHPHLLIEIKAVAYQPLPR