Protein Info for RR42_RS05075 in Cupriavidus basilensis FW507-4G11

Annotation: aminocarboxymuconate-semialdehyde decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 191 to 214 (24 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details PF04909: Amidohydro_2" amino acids 7 to 332 (326 residues), 111.4 bits, see alignment E=3.6e-36

Best Hits

Swiss-Prot: 41% identical to ACMSD_MOUSE: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (Acmsd) from Mus musculus

KEGG orthology group: K03392, aminocarboxymuconate-semialdehyde decarboxylase [EC: 4.1.1.45] (inferred from 73% identity to axy:AXYL_05543)

MetaCyc: 70% identical to 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase (Pseudomonas fluorescens KU-7)
Aminocarboxymuconate-semialdehyde decarboxylase. [EC: 4.1.1.45]

Predicted SEED Role

"2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45)" (EC 4.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.45

Use Curated BLAST to search for 4.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCP3 at UniProt or InterPro

Protein Sequence (337 amino acids)

>RR42_RS05075 aminocarboxymuconate-semialdehyde decarboxylase (Cupriavidus basilensis FW507-4G11)
MSANSVVDIHSHFFPPISRREAAALDPVAAPWLQANGTDTAMIMTGDQPFRPVYSALWDP
ARRIEEMDRCGVDIQLMCATPVMFGYRYPAHVAVPWSQRMNDYALELCAHRPARLKALAQ
VPLQDIDAACREASRAKAGGHVGVQIGNHLGERDLDDEGLITFLIHCANEGIAVLVHPWD
MMGAPRMKKWMLPWLVSMPAETQLGILSLILSGAFERIPASLKLCFAHGGGSFAFLLGRI
DNAWRHRDIVREDCPHPPSSYVNRFFVDSAVFDPRALKLLVDVMGEDRVMLGSDYPYPLG
EQQVGALIRATDLADAARRKLLGANAAAFFGLGDNKS