Protein Info for RR42_RS04750 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF03401: TctC" amino acids 57 to 327 (271 residues), 295.3 bits, see alignment E=1.8e-92

Best Hits

Swiss-Prot: 42% identical to YCLC_PSEPU: UPF0065 protein in clcB-clcD intergenic region from Pseudomonas putida

KEGG orthology group: None (inferred from 83% identity to reu:Reut_A2507)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y853 at UniProt or InterPro

Protein Sequence (333 amino acids)

>RR42_RS04750 ABC transporter substrate-binding protein (Cupriavidus basilensis FW507-4G11)
MPVPVEKQTATRPLLIAAAIAVLASGWLPSAASAADYPVKPIRFIVPYAAGGTTDLVART
VGQKVAEKLGQPVVVENRPGAGGNIGMEAVAKAAPDGYTIGFGAISTNALNPHIYKHVPF
DPRKDFTAVSLLGTSTIVLEVSNSLPVKNVAELVSYAKAHPGLTYATAGTGTSMHLAGAM
FSQMTQTGLTHVPYKGSSPAINDMLGGHLQVMFDNLPASLPHIQGGKLRALAVAGKSRSP
ALPNVPTLAEAGLAGYAVEPWFGVYGPAGLPAPVVQALNAAFVAALGNADVKDKLGQAGF
NPKGSSAADLQSLTLSEYEKFGKVAKSASISVD