Protein Info for RR42_RS04730 in Cupriavidus basilensis FW507-4G11

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF02844: GARS_N" amino acids 1 to 100 (100 residues), 131.7 bits, see alignment E=3.1e-42 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 420 (420 residues), 561.8 bits, see alignment E=4.5e-173 PF01071: GARS_A" amino acids 101 to 294 (194 residues), 256.6 bits, see alignment E=3.3e-80 PF02786: CPSase_L_D2" amino acids 103 to 207 (105 residues), 21.5 bits, see alignment E=2.9e-08 PF02843: GARS_C" amino acids 329 to 418 (90 residues), 110.5 bits, see alignment E=8.3e-36

Best Hits

Swiss-Prot: 85% identical to PUR2_RALSO: Phosphoribosylamine--glycine ligase (purD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 93% identity to reh:H16_A0915)

MetaCyc: 62% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y847 at UniProt or InterPro

Protein Sequence (422 amino acids)

>RR42_RS04730 phosphoribosylamine--glycine ligase (Cupriavidus basilensis FW507-4G11)
MKVLVVGSGGREHAMAWKLAQSPKVQVVYVAPGNGGTALDKRLQNVPLTDPEVLAAFAER
EGVSFTVVGPEAPLAAGIVDIFRAKGLRIFGPTQAAAQLESSKDFAKAFMQRHGIPTAAY
QTFNDAAAAHAYIDAQGAPIVIKADGLAAGKGVVVAATLAEAHAAVDMMLADNRLGDAGA
RVVIEEFLEGEEASFIVLVDGKNVLALATSQDHKRLLDHDAGPNTGGMGAYSPAPVVTPA
LHARALREIIMPTVRGMEKDGITYTGFLYAGLMIDSESNLKTLEFNCRMGDPETQPILAR
LKTDLVDVMEHAVNGKLDEIELDWDRRTALGVVMAAFGYPDAPRKGDAITGIPAETDDSV
TFHAGTTLNDGTLLTTGGRVLCVVGLADTVKAAQRAAYGAAEKIHFDGMQYRTDIGYRAI
KR