Protein Info for RR42_RS04680 in Cupriavidus basilensis FW507-4G11

Annotation: potassium transporter Kef

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 53 (23 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 19 to 394 (376 residues), 124.8 bits, see alignment E=1.9e-40

Best Hits

KEGG orthology group: None (inferred from 51% identity to reh:H16_B2511)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y834 at UniProt or InterPro

Protein Sequence (404 amino acids)

>RR42_RS04680 potassium transporter Kef (Cupriavidus basilensis FW507-4G11)
MNPVSLFFAQACLVVGTPFILWRGLRIGSIVPLVAMQIVGGILLGPSLLGALWPQGWQAL
FGPAQLSALSGLQWLAVVLFAFLSGLHIGGAQQPGIRRIAMAAALGSVLVPFALGTAAGA
WLAYATPDAVGHAASAWQFAFAVGVSMAVTALPVLGAILREMKLSDSVPGQLAVGCAAFS
DAAIWLVLSAILASAGRSSSYDFLRLACLGLAYVGAMLWLVRPLLARMLPRMAAVDARLA
LVAVLIFGSALISESIGLHYILGGFLAGVVLPRDAAGELRRQLEPATVVVLMPFFFLMTG
LRTDIAIGGQATLLVFGLSTMVAVAGKVVGAALPARLAGLPRREAWMLGALVQTKGLMEV
VVLGILFEAGLIGMTAFSGLLLMALATTVLAKPLTRAAARLRER