Protein Info for RR42_RS04645 in Cupriavidus basilensis FW507-4G11
Annotation: rhodanese superfamily protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 87% identical to Y810_CUPTR: UPF0176 protein RALTA_A0810 (RALTA_A0810) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)
KEGG orthology group: K07146, UPF0176 protein (inferred from 87% identity to cti:RALTA_A0810)Predicted SEED Role
"Rhodanese domain protein UPF0176, Betaproteobacterial subgroup"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4Y0F0 at UniProt or InterPro
Protein Sequence (285 amino acids)
>RR42_RS04645 rhodanese superfamily protein (Cupriavidus basilensis FW507-4G11) MQIVNISAYKFVSLDDIPVLRPEMRARCEAHGLKGTILLAPEGINLFLAGVREAIDSFLG WLHADPRFADIEPKESLSENQPFKRMLVREKKEIITMKMPLIRPEAGRAPAVTPVELKRW LDQGHDDAGRPVVMLDTRNAFEVAVGTFEQAVDYDIAKFSDFPPAIAAHKAEFAGKTIVS FCTGGIRCEKAAIHMQEAGIEHVYQLEGGILKYFEEVGGSHYQGDCFVFDYRTALNPNLE PAGPKQCFACRAVVTAEEQQSPHYVVGKSCPHCIGEGTGTAAAAA