Protein Info for RR42_RS04355 in Cupriavidus basilensis FW507-4G11

Annotation: recombination factor protein RarA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF05496: RuvB_N" amino acids 17 to 129 (113 residues), 40.7 bits, see alignment E=7.7e-14 PF01078: Mg_chelatase" amino acids 23 to 69 (47 residues), 22 bits, see alignment 3.5e-08 PF00004: AAA" amino acids 50 to 157 (108 residues), 53.7 bits, see alignment E=1.1e-17 PF07728: AAA_5" amino acids 50 to 128 (79 residues), 24.2 bits, see alignment E=1e-08 PF16193: AAA_assoc_2" amino acids 181 to 256 (76 residues), 78.2 bits, see alignment E=1.6e-25 PF12002: MgsA_C" amino acids 257 to 423 (167 residues), 216.3 bits, see alignment E=8.9e-68

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 90% identity to cti:RALTA_A0751)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5Y2 at UniProt or InterPro

Protein Sequence (455 amino acids)

>RR42_RS04355 recombination factor protein RarA (Cupriavidus basilensis FW507-4G11)
MFSEAPDRSQQPLAERLRPRNIDEVIGQQHLLGAGKPLRVAFASGEPHSMILWGPPGVGK
TTLARLMATAFDAEFIALSAVLSGVKDIREAVERAEQYRAHGRRTLVFVDEVHRFNKSQQ
DAFLPHVESGLFTFIGATTENPSFEVNGALLSRAAVYVLKSLDDAELTQLARRASEELGG
LQWEDEALQLIVASADGDGRKLLNNIEIVARAARSAGAPVIDNALLGSALSENLRRFDKG
GDAFYDQISALHKSVRGSDPDATLYWFCRMIDGGADPRYLARRIVRMAWEDIGLADPRAA
RITLDAAETYERLGSPEGELALAQALIYLAVAPKSNAGYNAYNTARAFVAKDKSRGVPVH
LRNAPTKLMKELGYGHAYRYAHDEPEAYAAGEHYFPDDLKRPGWYKPTPRGLEGKISDKL
RHLRDLDAQWLRQQGKGKGRGEGGGEGGGEGGAAQ