Protein Info for RR42_RS04335 in Cupriavidus basilensis FW507-4G11

Annotation: iron deficiency-induced protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01547: SBP_bac_1" amino acids 43 to 291 (249 residues), 72.6 bits, see alignment E=1.2e-23 PF13531: SBP_bac_11" amino acids 45 to 295 (251 residues), 56.8 bits, see alignment E=5.7e-19 PF13416: SBP_bac_8" amino acids 46 to 308 (263 residues), 86.2 bits, see alignment E=7e-28 PF13343: SBP_bac_6" amino acids 79 to 315 (237 residues), 91.1 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 51% identical to FUTA1_SYNY3: Iron uptake protein A1 (futA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 86% identity to reh:H16_A0759)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7Y9 at UniProt or InterPro

Protein Sequence (347 amino acids)

>RR42_RS04335 iron deficiency-induced protein A (Cupriavidus basilensis FW507-4G11)
MTVFRRLLPRATALAALAVLTLPLAAHAQEKVLNLYTARHYQTDEALYANFTKQTGIKIN
RIEGQEDPLLERIKSEGANSPADVFITVDIGRLWRAQQAGVFAPLKSSVLESRIPANYRD
PNGDWFGFSARARVIAYNKAAVKPGDIKTYEDLADPRWKGKLCIRSSGHVYNLSLMSSLI
AHDGEAKTEQWTRGVVANLARAPKGGDTDQLKAVAAGECDIAVANTYYIARILKSAKPED
KAVAEKLGVLWPNQASQGVHMNISGGGMLKHAPNKASARAFLEYLASNDAQRYFADGNNE
WPVVESVKISNPALEALGSFKADKINVAELGKHQPQAQKLADKAGYK