Protein Info for RR42_RS04195 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF05987: DUF898" amino acids 23 to 358 (336 residues), 387.5 bits, see alignment E=2.8e-120

Best Hits

KEGG orthology group: None (inferred from 70% identity to reh:H16_A2983)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5K9 at UniProt or InterPro

Protein Sequence (365 amino acids)

>RR42_RS04195 membrane protein (Cupriavidus basilensis FW507-4G11)
MQLDNNAFHAAAYEQPAATVRPLRFEFIGSGSEFFRIWIVNTLLTIVTLGIYSAWAKVRT
MQYFYRNTRLDGASFDYHGRASAILKGRAIVFGLAMVFQLASHISLFVALALGLALAVVF
PLLLVRSLRFRMANSSYRGLRFAFTGSDAQAYKVFLLWPVLTALSLYALAPLAHQRFKQY
QHDNTRFGTAPFGISASAGGFYGVYLRAFGMMVAVVVGMSVAGGMLGRGIGAGIGAGMGA
GMGAPAVAGIMAVIGFFVAMMAVGPFFMARLQNLVWNHTTLAPHAFRSEVKAGRLLFIFA
TNMIANALTLGLFLPFARVRSMRYRIESMTMLAAGPLDAFVAGETQHVGALGDAAVDWYD
IDIAL