Protein Info for RR42_RS04075 in Cupriavidus basilensis FW507-4G11

Annotation: molecular chaperone GroES

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00166: Cpn10
  • amino acids 2 to 94 (93 residues), 121.7 bits, E=5.3e-40

Best Hits

Swiss-Prot: 95% identical to CH10_CUPNH: 10 kDa chaperonin (groS) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K04078, chaperonin GroES (inferred from 95% identity to reu:Reut_A2657)

MetaCyc: 55% identical to cochaperonin GroES (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

See A0A0C4Y7W0 at UniProt or InterPro

Protein Sequence (96 amino acids)

>RR42_RS04075 molecular chaperone GroES (Cupriavidus basilensis FW507-4G11)
MNLRPLHDRVIVKRLDNETKTASGIVIPDNAAEKPDQGEVLAVGPGKKDDKGASIVLDVK
VGDRVLFGKYAGQAVKVDGQELLVMREEDIMAVVNK