Protein Info for RR42_RS03935 in Cupriavidus basilensis FW507-4G11

Annotation: purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 18 to 428 (411 residues), 359.8 bits, see alignment E=2e-111 PF00860: Xan_ur_permease" amino acids 18 to 394 (377 residues), 326.1 bits, see alignment E=1.3e-101 TIGR03173: xanthine permease" amino acids 21 to 430 (410 residues), 496.8 bits, see alignment E=4.1e-153

Best Hits

Swiss-Prot: 48% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 56% identity to azl:AZL_d02140)

MetaCyc: 48% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y061 at UniProt or InterPro

Protein Sequence (433 amino acids)

>RR42_RS03935 purine permease (Cupriavidus basilensis FW507-4G11)
MTGDRPAAVDQVLAPGPLVILGLQHVLVMYVGAIAVPMIIASALKLPKEAVAVLINADLF
TCGIATILQAAGVWRFGVRMPVMQGVAFSAIPPILVIATNPALGLPAVVGAVMAGGVITM
LLAPVFGKLLRFFPPIVGGSIVMVVGLSLFPVGVNWVGGGRGAPDFGAPHHLALAGFVFA
LILVINKWLKGFWSNVSVLLALAAGMLAAIPFGMVDFHGVAEAPMVDVIHPFYFGWPVFD
VVATLTIVVVMIIIMIESMGLFLAIGDVVNKPLSAGEMTDGLRANGLASVIGGALNGFPY
TIYSQNIGLLVVTGVKSRWVVVAAGVILCALGLFPKLATVVASIPLPALGGAGLFMFGVV
TSAGVRTLARVDFEGTRHNVYIVAATLAISLLPTFSGTLFNQLPGWLQPIMHSSILLACV
MSVVLNLLFNGMA