Protein Info for RR42_RS03885 in Cupriavidus basilensis FW507-4G11

Annotation: mammalian cell entry protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details PF02470: MlaD" amino acids 53 to 145 (93 residues), 52 bits, see alignment E=3.5e-18 amino acids 169 to 229 (61 residues), 43.3 bits, see alignment E=1.8e-15 amino acids 303 to 400 (98 residues), 51.5 bits, see alignment E=4.9e-18

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 82% identity to reh:H16_A0682)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y056 at UniProt or InterPro

Protein Sequence (543 amino acids)

>RR42_RS03885 mammalian cell entry protein (Cupriavidus basilensis FW507-4G11)
MPDLDQSPPSPSSQPPAPERRRRARWLPSLVWLIPIVAAVVGLSLLIHTLTERGPEITVT
FRTAEGLVPGKTPVRYKDVDIGLVKSVRLAGDHSHVIARIDLTQDAASFSTRDTRFWVVR
PRFATSGISGLGTLLSGAYIGVDAGKSEERVRDFTGLEVPPAVTTDASGKQFVLRATDLG
SLDIGSPVYYRRVQVGQVVAYQLEPNGRDLSLRVFINKPYDKLVTADSRFWHASGVDIKL
DAGGFKLNTQSLVTVLLGGVAFQAPDDSKATDAANENTQFLLASDQTEAMKEPEEIAPSL
AVLNFDQSVRGLSPGAPVDFRGVVVGQVRSIGIEYQVEKKAFRLPVVVELYPSRMGFRAR
DVEDVNRARNIVQTLIKRGMRAQLRTGNLLTGQLYVALDFFPKAPPATVNLDGAMPELAT
TPGAFDELQAKLGDIVNKIDKVPFEQIGQDLRTSIATLNTMMTSADKLVAQLNGDVAPQV
LAALQDARKTLSAANGTLASDAPLQQDTRRMMQELTRTAVSLRTLTEYLERHPEALVRGK
PEK