Protein Info for RR42_RS03830 in Cupriavidus basilensis FW507-4G11

Annotation: molybdenum ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00005: ABC_tran" amino acids 27 to 168 (142 residues), 108 bits, see alignment E=6e-35

Best Hits

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 82% identity to cti:RALTA_A0631)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y048 at UniProt or InterPro

Protein Sequence (240 amino acids)

>RR42_RS03830 molybdenum ABC transporter ATPase (Cupriavidus basilensis FW507-4G11)
MTMQVTVRKQLGSADRRFGLDIAFDSASKRIALFGPSGAGKSLTLRAIAGLLTPDSGRIV
LNGRTLFDSETHVNVRPQERRVAYLFQDYALFPHLTVAQNIAFGLERGWRNPRRNTHHPQ
AQRWIDAFGLGAITGNYPGEISGGQKQRAALARALAARPDIVLLDEPFSALDPALRVRMR
AELRALQASLEVPMLVISHDPDDVEALGDHVLEVREGRIFGAAPVKGHPQVYAPVSARAV