Protein Info for RR42_RS03825 in Cupriavidus basilensis FW507-4G11

Annotation: ModE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00126: HTH_1" amino acids 23 to 83 (61 residues), 37.1 bits, see alignment E=2.5e-13 TIGR00638: molybdenum-pterin binding domain" amino acids 127 to 193 (67 residues), 79.2 bits, see alignment E=1.8e-26 amino acids 198 to 264 (67 residues), 69.9 bits, see alignment E=1.4e-23 PF03459: TOBE" amino acids 128 to 191 (64 residues), 60.8 bits, see alignment E=1.2e-20 amino acids 201 to 263 (63 residues), 63.5 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 80% identity to reh:H16_A0672)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC55 at UniProt or InterPro

Protein Sequence (267 amino acids)

>RR42_RS03825 ModE family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MLELDGAIWFRSGSQDWGGRERIALLAAIGEHGSITAAAKAVGLSYKGAWDAIDAMNNSA
GEPLVVRAAGGKGGGGTVLTERAASLIRTYRALEHEHRLFIEHLASLGNVSETAQDDLHL
MRRFMIKTSARNKLFGKVAAIRGGAVNDEVTLSLAGGQHVVATITHESVETLGLVPGAEA
FALIKASSVLLGLPDPGLRLSARNQLPGKVTRVLPGAVNAEVALELDGGGTVVAVVTNDS
VSALGLAEGSRALAIFKASSVILGTMG