Protein Info for RR42_RS03520 in Cupriavidus basilensis FW507-4G11

Annotation: type VI secretion protein EvpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR03355: type VI secretion protein, EvpB/VC_A0108 family" amino acids 17 to 491 (475 residues), 721 bits, see alignment E=3.4e-221 PF05943: VipB" amino acids 67 to 369 (303 residues), 444.8 bits, see alignment E=1.4e-137 PF18945: VipB_2" amino acids 379 to 490 (112 residues), 152.6 bits, see alignment E=4.6e-49

Best Hits

KEGG orthology group: K11900, type VI secretion system protein ImpC (inferred from 97% identity to cti:RALTA_A0609)

Predicted SEED Role

"Uncharacterized protein ImpC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC07 at UniProt or InterPro

Protein Sequence (497 amino acids)

>RR42_RS03520 type VI secretion protein EvpB (Cupriavidus basilensis FW507-4G11)
MASAQQTQQQALATAEHSDFAALIGREFSPKTDQAREAVDLAVKTLAEQALASSFTMSDD
AYKSIEAIIGAIDTKLSEQINLILHHQDFQKLESAWRGLHHLVSNTETDDKLRIRVMDVS
KEDLRRTLRRYKGIGWDQSPFFKRIYEEEYGQLGGEPYGCLVADYYFDHTPPDVELLGSL
AKISAAAHAPFIAGASPSVLQMDSWQELANPRDLSKIFQNLEYAPWNGLRNSEDARYVGL
AMPRFLSRLPYGIKTNPVDEFDFEEDTDGADHRKYVWSNAAYAMAVNINRSFKLYGWCTL
IRGVESGGVVENLPCHTFPTDDGGLDMKCPTEIAISDRREAELSKNGFISLVHRKNTDYA
AFIGAQSMQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDMEGNPGYYSAKFFLRPHFQLEGL
TVSLRLVARLPSVKDAA