Protein Info for RR42_RS03470 in Cupriavidus basilensis FW507-4G11

Annotation: flagellar motor protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 66 to 190 (125 residues), 118.8 bits, see alignment E=6.5e-39

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 93% identity to rme:Rmet_0537)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBZ7 at UniProt or InterPro

Protein Sequence (206 amino acids)

>RR42_RS03470 flagellar motor protein MotA (Cupriavidus basilensis FW507-4G11)
MFSIIQAAGWPIWPLLLASVIALALIVERFLSLKRSKVLPPKLYDEALSVAHQRRATPEV
VNTLEQDSPLGRVLAAGLRHVVLQPHTSRDAAKEVVEEAGRAVAHELERYLNALGTIASV
APLMGLLGTVIGMIEIFGSQGGAGASPEQLAHGISVALYNTAFGLIIAIPALIFWRYFRR
RVDDYVAELEFRATAFLDAILPQRRA