Protein Info for RR42_RS03400 in Cupriavidus basilensis FW507-4G11

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 150 to 293 (144 residues), 36.3 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 90% identity to reu:Reut_A0581)

Predicted SEED Role

"FIG00974913: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZX5 at UniProt or InterPro

Protein Sequence (297 amino acids)

>RR42_RS03400 permease (Cupriavidus basilensis FW507-4G11)
MSSALLLVPDFSLILIGWLLVRYSPFDRAFWAGVERLVYFVLFPALLLQSTNSARFDFSS
TSAMLGLALLTTAFGMVGGYAVKWTMRLAPLDFASGLQTAFRFNSYIGLALASRLGGSEG
LAMMAVIVGCTVPLCNVAAVWALARHGETRLWRELARNPLILATAGGLLTNLAGLHPPEV
VGMTLARLGSASTALGLMTVGAGLQMSGVTGAVGPVAWWSGVKLVAMPCFAWAVGRLLPL
TELQSQIVVLFASLPTASSAYILAVRMGGNGPMVAATISVMTVAAIVTTPFWLSLVS