Protein Info for RR42_RS03240 in Cupriavidus basilensis FW507-4G11

Annotation: integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF13384: HTH_23" amino acids 11 to 55 (45 residues), 33.3 bits, see alignment 1.1e-11 PF13011: LZ_Tnp_IS481" amino acids 12 to 67 (56 residues), 43.3 bits, see alignment 1.6e-14 PF13551: HTH_29" amino acids 13 to 68 (56 residues), 37.3 bits, see alignment 8.2e-13 PF13518: HTH_28" amino acids 14 to 63 (50 residues), 45.6 bits, see alignment 2e-15 PF13565: HTH_32" amino acids 39 to 115 (77 residues), 55.8 bits, see alignment E=1.9e-18 PF00665: rve" amino acids 142 to 245 (104 residues), 38.9 bits, see alignment E=3.1e-13 PF13683: rve_3" amino acids 234 to 298 (65 residues), 59 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 58% identity to ppf:Pput_3520)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEC3 at UniProt or InterPro

Protein Sequence (390 amino acids)

>RR42_RS03240 integrase (Cupriavidus basilensis FW507-4G11)
MPWSELKPMDQRILFVVDHVKGVESMSALCARYGVSRKTGYKWLERYEAEGLDGLAERSR
RRREQDRVPYAIRQAILALRTQGGMEQGPKKIQKLLEARYGAELVPSRTTIYNVLKQAGR
ILPRRLRRRVMPHEGVLRSTQEPNGLWSADYKGQFLTGDHRWCYPLTVMDHASRYLLGCK
GLNGPQLVPTRAVFEQLFRRYGLPDRLRTDNGVPFASTGSAGLSQLSIWWLKLGIVPERI
ERGHPEQNGRHERMHRTLKRATAQPPAATLSSQQRRMDEFRRYYNRERPHEALEQCTPQS
CYTKSMRAYPSRLEEMSYASYILPHRVTKAGLIYQAGKIIYVGHLLQGEVVGLEAVADGI
WRVHFGPIAIGLIDERQAKQHYLTIKVLPM