Protein Info for RR42_RS03225 in Cupriavidus basilensis FW507-4G11

Annotation: N5-carboxyaminoimidazole ribonucleotide mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 9 to 156 (148 residues), 201.3 bits, E=2.8e-64
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 9 to 158 (150 residues), 199.3 bits, E=1.3e-63

Best Hits

Swiss-Prot: 60% identical to PURE_VIBPA: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 91% identity to reh:H16_A0570)

MetaCyc: 57% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See A0A0C4Y5C7 at UniProt or InterPro

Protein Sequence (165 amino acids)

>RR42_RS03225 N5-carboxyaminoimidazole ribonucleotide mutase (Cupriavidus basilensis FW507-4G11)
MSNTAKPLVGVVMGSSSDWDVMQNAVAMLKDFGVAFEARVVSAHRMADDMFEYAATARER
GLRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSRYLRGEDSLLSIVQMPKGVPVATFAI
GEAGAANAALHAIATLATTDDALAAALEAFRAKQTEAARAMTLPV