Protein Info for RR42_RS03140 in Cupriavidus basilensis FW507-4G11

Annotation: molybdenum cofactor biosynthesis protein MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 4 to 152 (149 residues), 197.4 bits, see alignment E=5.1e-63 PF01967: MoaC" amino acids 15 to 150 (136 residues), 191.5 bits, see alignment E=3.2e-61

Best Hits

Swiss-Prot: 90% identical to MOAC_CUPMC: Cyclic pyranopterin monophosphate synthase (moaC) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 90% identity to rme:Rmet_0486)

MetaCyc: 56% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBT8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>RR42_RS03140 molybdenum cofactor biosynthesis protein MoaC (Cupriavidus basilensis FW507-4G11)
MSQLTHFDSAGQAHMVDVGAKAHSHRVAVATGTITMLPATFALVRDGTAKKGDVLGIARV
AAIMATKRTSDLIPLCHPISLTKVAVDYAMDEASATIRCTVRTETHGQTGVEMEALTGVQ
VALLTIYDMCKAVDRGMVIGDVKLLEKHGGKSGDWVAEKT