Protein Info for RR42_RS03105 in Cupriavidus basilensis FW507-4G11

Annotation: integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 13 to 190 (178 residues), 226.6 bits, see alignment E=8.7e-72 PF03741: TerC" amino acids 15 to 189 (175 residues), 165.9 bits, see alignment E=4.3e-53

Best Hits

Swiss-Prot: 41% identical to YJBE_BACSU: Uncharacterized membrane protein YjbE (yjbE) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 91% identity to cti:RALTA_A0504)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBT3 at UniProt or InterPro

Protein Sequence (231 amino acids)

>RR42_RS03105 integral membrane protein (Cupriavidus basilensis FW507-4G11)
MELLSSTAFWIALGSIILTNIVLSGDNAVVIALASRNLPPAQQKKAIFWGSAAAIIMRVV
LTVAAVKLLSLPYLKIVGAVLLVYIGVQLLTGDDDEEGHSAKDNIWAAIRTILIADLVMS
LDNVVAVAAAAQKGPEGSQLMLLILGLGLSIPLIVFGSTVLLKVMDRFPIIIVLGAALLG
YLAGEMLVSDPVDAAWFEMHVPHAHLVFGVIGAALVVVVGKLLSKRAPQTA