Protein Info for RR42_RS03080 in Cupriavidus basilensis FW507-4G11

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR02012: protein RecA" amino acids 14 to 335 (322 residues), 566.7 bits, see alignment E=7.9e-175 PF00154: RecA" amino acids 17 to 279 (263 residues), 474.8 bits, see alignment E=1.9e-146 PF06745: ATPase" amino acids 50 to 225 (176 residues), 30 bits, see alignment E=8.4e-11 PF21096: RecA_C" amino acids 282 to 337 (56 residues), 95.9 bits, see alignment E=3e-31

Best Hits

Swiss-Prot: 92% identical to RECA_CUPTR: Protein RecA (recA) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K03553, recombination protein RecA (inferred from 92% identity to cti:RALTA_A0499)

MetaCyc: 71% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBS9 at UniProt or InterPro

Protein Sequence (357 amino acids)

>RR42_RS03080 recombinase RecA (Cupriavidus basilensis FW507-4G11)
MDDGKKAGAGVSAEKQKALAAALAQIEKQFGKGSIMKLGEADIDQDIQVVSTGSLGLDIA
LGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVNYAGKLGVS
VGDLLISQPDTGEQALEITDALVRSGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARL
MSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGS
IKKGDEVIGNETKVKVVKNKVSPPFREAFFDILYGQGISRQGEIIDLGVDAKVVEKSGAW
YSYKGEKIGQGKDNAREYLRENPDIAGEIENRVRESLGVVLMNATPATAGAVVTAED