Protein Info for RR42_RS03070 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 63 to 208 (146 residues), 156.1 bits, see alignment E=1.2e-49 PF00512: HisKA" amino acids 286 to 349 (64 residues), 59.4 bits, see alignment E=5.9e-20 PF02518: HATPase_c" amino acids 397 to 511 (115 residues), 91.6 bits, see alignment E=9e-30 PF14501: HATPase_c_5" amino acids 401 to 489 (89 residues), 22.3 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 86% identity to cti:RALTA_A0497)

Predicted SEED Role

"Two-component system sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7C6 at UniProt or InterPro

Protein Sequence (518 amino acids)

>RR42_RS03070 histidine kinase (Cupriavidus basilensis FW507-4G11)
MSLLRLPRRRARAARPARAPSPPDEIVSDETLAEALPHLEDSAGHPSPRSLFGEILDWML
APLLLLWPMSIAVTYLVAKSIANGPFDRSLEASAIVLSQQVREVNGRVTLQLPLSAREIL
RADETDNIYYQVVGTHGEFVAGDNDMPLPGEDDRGHAGLVSLRDDRIAGNDVRVAYTYVD
LKQAGDAQPVLVQVGETLDKRARLANEIIKGVILPQFVILPLAVVLVWFGLTRGLAPLTS
IQQRIRARNPGDTSPIDERAAPQEITPLVASFNDLLARLDVSVQTQKRFIADAAHQMKTP
LAGLRMQAELAQREQSPEELRKSLAQIAGSSERAAHLVTQLLSLARMENLAGAGSMAPLD
LAALAREVVKDWLPQAWARRIDLGVDADDHPVMVQGNRLMLTEMLNNLIDNAIRYTPADG
HATVRVSADAFEPFAYLEVEDTGCGIPVAERERVMERFYRVLGTKTQGSGLGLAIVREIV
QQHGGDVTILDHVYQTEPRLAGACFRITLRRPSPLEPA