Protein Info for RR42_RS03040 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Outer membrane protein (NodT-like) required for 4-hydroxybenzoate transport, together with FUSC, MFP, and DUF1656 proteins (RR42_RS03025, RR42_RS03035, and RR42_RS03030)
Rationale: specific phenotype on 4-hydroxybenzoate and cofit with other nearby components. Not clear if this is primarily an efflux pump (because of the high and potentially toxic concentration of hydroxybenzoate) or for uptake
Original annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 14 to 470 (457 residues), 292.2 bits, see alignment E=3.6e-91 PF02321: OEP" amino acids 70 to 260 (191 residues), 58.7 bits, see alignment E=3.5e-20 amino acids 290 to 468 (179 residues), 70.4 bits, see alignment E=9e-24

Best Hits

KEGG orthology group: None (inferred from 77% identity to rme:Rmet_4790)

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7B9 at UniProt or InterPro

Protein Sequence (487 amino acids)

>RR42_RS03040 Outer membrane protein (NodT-like) required for 4-hydroxybenzoate transport, together with FUSC, MFP, and DUF1656 proteins (RR42_RS03025, RR42_RS03035, and RR42_RS03030) (Cupriavidus basilensis FW507-4G11)
MNTLRKALLPALVPLLFAACTTVGPDYHVPDNAAVKAQAANGPLLGTNNPAVSIAEVPDG
WWRLYDDPKLDQLVQQALVANTDLRVAAANLKRAIAVYHEVEAENLPEARLSAGAERGQI
AGEPLLKEEKIPVMNFGDVGFKVSYLIDFFGKLARADEAALAGAQASQAALDQARIGVVA
ETVRAYVQGCAATHELTVAEHQLALQSRGVELARKMVDAGRGQPLDLLRAQAQADVLRAA
LPRFKAEQEGAAYRLAVMLGKPPSATSQAEYACHEEPRLRQALPVGDGAALLKRRPDVRQ
AERELASATAKIGVATADLYPSIRIGASAGFTGILDHLGQAPTAHWGYGPLITWNIPTSG
TRARVHGTEAGAEAALAHFDGVVLKALRETQSALSSYTRELERTQALRDARDKANEVARQ
NRQLYQAGRSPYLSSLDADRTLASTEASLAASESQVALDQINLFLALGGGWQNAPKVESR
TMSEQAH