Protein Info for RR42_RS02975 in Cupriavidus basilensis FW507-4G11

Annotation: malonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 169 to 195 (27 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details TIGR00808: malonate transporter, MadM subunit" amino acids 7 to 258 (252 residues), 412.7 bits, see alignment E=3.1e-128 PF03818: MadM" amino acids 9 to 256 (248 residues), 390.5 bits, see alignment E=1.7e-121

Best Hits

KEGG orthology group: None (inferred from 87% identity to reu:Reut_A1612)

Predicted SEED Role

"Malonate transporter, MadM subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y587 at UniProt or InterPro

Protein Sequence (258 amino acids)

>RR42_RS02975 malonate transporter (Cupriavidus basilensis FW507-4G11)
MPHSISHIIENILLQNALVTAFAAVGIIMWLSSRLSRWLTVGRVHASAIAIVIGLLLAYY
GGIVTGKEKGLADLSLFSGIGLMGGAMLRDFAIVATAFEVQVTEARKAGLVGAVSLLLGT
ILPFIVGAAVARAFGYSDAVSMTTIGAGAVTYIVGPVTGAALGASSDVIALSIATGLIKA
IIVMVGTPMAAGFLGLNNPRAAMVFGGLAGTVSGVSAGLAATDRRLVPYGALVATFHTGL
GCLLGPSLLFLATKAVVG