Protein Info for RR42_RS02950 in Cupriavidus basilensis FW507-4G11

Annotation: malonate decarboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 149 to 174 (26 residues), see Phobius details TIGR03133: biotin-independent malonate decarboxylase, beta subunit" amino acids 10 to 279 (270 residues), 388.6 bits, see alignment E=7.4e-121 PF01039: Carboxyl_trans" amino acids 17 to 240 (224 residues), 53.9 bits, see alignment E=6.3e-19

Best Hits

KEGG orthology group: K13932, malonate decarboxylase beta subunit (inferred from 77% identity to pna:Pnap_0949)

MetaCyc: 68% identical to malonate decarboxylase malonyl-[acp] decarboxylase component alpha subunit (Klebsiella pneumoniae)
Biotin-independent malonate decarboxylase. [EC: 4.1.1.88]; Malonyl-S-ACP decarboxylase. [EC: 4.1.1.88, 4.1.1.87]

Predicted SEED Role

"Malonate decarboxylase beta subunit" in subsystem Malonate decarboxylase

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.88

Use Curated BLAST to search for 4.1.1.87 or 4.1.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZN5 at UniProt or InterPro

Protein Sequence (283 amino acids)

>RR42_RS02950 malonate decarboxylase subunit beta (Cupriavidus basilensis FW507-4G11)
MNHASLLNRESFVELGARARVHALLDPGTLRELAGPFDQLVSPWLERQGVVPQADDGVVV
AKGRIDGHPAVVLAIEGAFQGGSLGEVGGAKIAGALELAAQDNRRGVPTRAVILFETGGV
RLQEANLGLAAIAEIHAGIVDLRRYQPVVGVIAGTVGCFGGMSIAAGLCSCLVVTREARL
GLNGPAVIEQEAGIAEYDSRDRPFIWSFTGGEQRIATGLADRYVEDDSDAIRTTVREVLA
QGVPAVHRSERYAHYLQRLAEYDPARQPEPQTVRTIYTHGATP